PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g111680.1
Common NameMTR_3g111680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family BES1
Protein Properties Length: 316aa    MW: 34637.5 Da    PI: 9.6022
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g111680.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.12.4e-64121522137
           DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                      +s+rkp+w+ErEnn+rRERrRRaiaakiyaGLR+qGny+lpk++DnneVlkALc+eAGw+ve+DGttyr+gs+ ++  + ag++++++p ss++
  Medtr3g111680.1  12 SSRRKPSWRERENNRRRERRRRAIAAKIYAGLRSQGNYNLPKHCDNNEVLKALCAEAGWTVEEDGTTYRRGSRAETPGDGAGNFNRNNPFSSQN 105
                      799******************************************************************************************* PP

           DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa.....asll 137
                      +s+ ss+++sp++sy+ sp+sssfpsps++d +++as+      +++
  Medtr3g111680.1 106 LSPLSSSFPSPIPSYQVSPSSSSFPSPSRMDANNNASNyipyaRTMF 152
                      *********************************99977665544444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.0E-5813143IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MASDGATSAA NSSRRKPSWR ERENNRRRER RRRAIAAKIY AGLRSQGNYN LPKHCDNNEV  60
LKALCAEAGW TVEEDGTTYR RGSRAETPGD GAGNFNRNNP FSSQNLSPLS SSFPSPIPSY  120
QVSPSSSSFP SPSRMDANNN ASNYIPYART MFPNMSLPPL RISNSAPVTP PVSSPTSRNP  180
KPMIPTWESI AKASGTSFNH PFFAASAPTS PSHRNLYTPP TIPECDESDT STVESGQWLN  240
FQAFAASAKS VSPTLNFMKP VINEQHNMLP HNRMQEMRIS EPEFGVQVKP WVGERIHEVG  300
LDDLELTLGN GKAPS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11332RRKPSWRERENNRRRERRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.23570.0leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0516570.0BT051657.1 Medicago truncatula clone MTYF5_F6_F7_F81G-D-20 unknown mRNA.
GenBankBT1352470.0BT135247.1 Medicago truncatula clone JCVI-FLMt-16I7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462104.10.0brassinazole-resistant 1 protein
SwissprotQ8S3071e-110BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLB7FHU20.0B7FHU2_MEDTR; Brassinazole-resistant 1 protein
STRINGGLYMA06G03700.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.29e-80BES1 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]